PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027541m
Common NameCARUB_v10027541mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 274aa    MW: 31653.4 Da    PI: 6.9554
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027541mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.2e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l++ +  +G  +W+t++   g+ R +k+c++rw +yl
  Carubv10027541m 14 KGLWSPEEDQKLKNFIISHGHACWTTVPLLAGLQRNGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding54.72.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE+++++ ++  lG++ W++Ia++++ gRt++++k++w++yl
  Carubv10027541m  67 RGTFSEEEEDIILTLHSSLGNK-WSRIAKYLP-GRTDNEIKNYWHSYL 112
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-20964IPR009057Homeodomain-like
PROSITE profilePS5129414.954961IPR017930Myb domain
SuperFamilySSF466895.5E-2811108IPR009057Homeodomain-like
SMARTSM007179.8E-101363IPR001005SANT/Myb domain
PfamPF002496.5E-121461IPR001005SANT/Myb domain
CDDcd001678.38E-81761No hitNo description
PROSITE profilePS5129425.98962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2565115IPR009057Homeodomain-like
SMARTSM007178.6E-1766114IPR001005SANT/Myb domain
PfamPF002492.6E-1667112IPR001005SANT/Myb domain
CDDcd001673.46E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MTKSGERPKQ RQRKGLWSPE EDQKLKNFII SHGHACWTTV PLLAGLQRNG KSCRLRWINY  60
LRPGLKRGTF SEEEEDIILT LHSSLGNKWS RIAKYLPGRT DNEIKNYWHS YLKKRWLKSQ  120
PQLKTQISDI TESTSSLLSC GKRNLEAETL NHVISFEKLA ELPSSSSSPL PQQENNTNMM  180
MNNDKYLPKL FFSEWISSSN PHIDYSTGVV TDSKHVSQTQ DQIDEEEVMM INNSYSSLED  240
VMLRTDQFLQ PDHDYANYYS SGDFFINNDQ SYV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26141157107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196360.0AY519636.1 Arabidopsis thaliana MYB transcription factor (At5g52260) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279733.10.0hypothetical protein CARUB_v10027541mg
SwissprotQ9M0K41e-92LAF1_ARATH; Transcription factor LAF1
TrEMBLR0EUZ20.0R0EUZ2_9BRAS; Uncharacterized protein
STRINGAT5G52260.11e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-158myb domain protein 19